PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009616250.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 251aa    MW: 29210.6 Da    PI: 8.8878
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009616250.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.51.5e-18449147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W + Ede+l ++v+++G+++W++Ia+ ++ gR++k+c++rw++ 
   XP_009616250.1  4 RGHWRPHEDEKLRELVAKYGPHNWNAIAENLQ-GRSGKSCRLRWYNQ 49
                     899*****************************.************96 PP

2Myb_DNA-binding54.42.8e-175699146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     r ++T+eE+e+l+  ++ +G++ W+ Iar ++ gRt++ +k++w+ 
   XP_009616250.1 56 RSPFTEEEEERLLASHRIHGNR-WAIIARLFP-GRTDNAVKNHWHV 99
                     789*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.281154IPR017930Myb domain
SMARTSM007171.3E-16352IPR001005SANT/Myb domain
SuperFamilySSF466891.65E-29497IPR009057Homeodomain-like
PfamPF002499.8E-18450IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.2E-27557IPR009057Homeodomain-like
CDDcd001677.30E-15748No hitNo description
SMARTSM007172.4E-1555103IPR001005SANT/Myb domain
PROSITE profilePS5129421.5555105IPR017930Myb domain
PfamPF002494.6E-145698IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.4E-2158104IPR009057Homeodomain-like
CDDcd001672.16E-115898No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MCSRGHWRPH EDEKLRELVA KYGPHNWNAI AENLQGRSGK SCRLRWYNQL DPRINRSPFT  60
EEEEERLLAS HRIHGNRWAI IARLFPGRTD NAVKNHWHVI MSRRCRERSK IYSMRNIAAA  120
PKSTSQQDIL TTSPSHDIMR KTSSNNSIDH QQLLGRFNYY PFITNNNSLY PKELHFNHLP  180
AHHLKMDEGK NEAMQCYDFL RVNTGSNKSE VVEDNITRRG DEEVEQEAGD NSLQSKAPVR  240
FIDFLSVGDS S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-3441057108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009616250.10.0PREDICTED: transcriptional activator Myb-like
RefseqXP_016466774.10.0PREDICTED: transcriptional activator Myb-like
TrEMBLM1D2B81e-113M1D2B8_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000797141e-113(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA17842466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.11e-81myb domain protein 52